Clik here to view.
Synthesis, biological evaluation and docking analysis of...
COMPD HAS cas no 1616882-93-9 MF……….C18 H11 F3 N2 O2 [1]Benzopyrano[4,3-c]pyrazol-4(1H)-one, 3-methyl-1-[4-(trifluoromethyl)phenyl]-...
View ArticleClik here to view.
Zifaxaban, TY-602, Zhifeishaban 知非沙班……Tianjin Institute of Pharmaceutical...
Zifaxaban Zifaxaban cas 1378266-98-8 rotation (-) C20 H16 Cl N3 O4 S C20H16ClN3O4 S, M = 429.87 Tianjin Institute of Pharmaceutical Research Deep vein thrombosis; Lung embolism Factor Xa antagonist...
View ArticleClik here to view.
MSA 100 a serotonin receptor antagonist.
(2E)-N-[2-[2-[(2S)-1-Methyl-2-piperidinyl]ethyl]phenyl]-3-phenyl-2-propenamide (1) (S)-2′[2-1-(methyl-2-piperidyl) ethyl] cinnamanilide...
View ArticleClik here to view.
N-{2-[7-(Cyclohexylmethyl)-1,6-dihydro-2H-indeno[5,4-b]furan-8-yl]ethyl}aceta...
N-[2-(7-Benzyl-1,6-dihydro-2H-indeno[5,4-b]furan-8-yl)ethyl]acetamide N-{2-[7-(Cyclohexylmethyl)-1,6-dihydro-2H-indeno[5,4-b]furan-8-yl]ethyl}acetamide Acetamide,...
View ArticleClik here to view.
US Orphan status for Bexion’s brain tumour drug BXQ-350
SDVYCEVCEFLVKEVTKLIDNNKTEKEILDAFDKMCSKLPKSLSEECQEVVDTYGSSILSILLEEV SPELVCSMLHLCSG [SEQ ID NO: 2]. BXQ-350 Cincinnati Children’s Hospital ……..innovator Bexion Pharmaceuticals……….under license In...
View ArticleClik here to view.
What is SMU-B?
cas 1253286-89-3 Spiro[3H-indole-3,4′-piperidin]-2(1H)-one, 5-[6-amino-5-[(1R)-1-(2,6-dichloro-3-fluorophenyl)ethoxy]-3-pyridinyl]-1′-methyl- SMU-B or is it 1253286-90-6...
View ArticleClik here to view.
AZD 3264 an IKK2 Inhibitor from Astra Zeneca
AZD 3264 MW 441.50 CAS 1609281-86-8 MF C21 H23 N5 O4 S 3-Thiophenecarboxamide, 2-[(aminocarbonyl)amino]-5-[4-(3,5-dimethyl-4-isoxazolyl)-2-[(3S)-3-pyrrolidinyloxy]phenyl]-...
View ArticleClik here to view.
What is SBM-TFC-039 an SGLT Inhibitor from Sirona Biochem !!
A new “flozin” seems to me appearing on the horizon in form of SBM-TFC-039 an SGLT Inhibitor from Sirona Biochem, picked up a list from WO 2012160218, from TFChem…….see link , Sirona Biochem Announces...
View ArticleClik here to view.
Gamendazole a novel drug candidate for male contraception.
Gamendazole (E) 3-(1-(2,4-Dichlorobenzyl)-6-(trifluoromethyl)-1H-indazol-3-yl)acrylic Acid trans-3-(1-Benzyl-6-(trifluoromethyl)-1H-indazol-3-yl)acrylic acid)...
View ArticleClik here to view.
New Parathyroid Disease Drug Etelcalcetide Seeks FDA Approval
Etelcalcetide, AMG 416 AMG-416; Etelcalcetide hydrochloride; KAI-4169; KAI-4169-HCl; ONO-5163; Telcalcetide; Velcalcetide; Velcalcetide hydrochloride D-Argininamide,...
View ArticleClik here to view.
GSK1904529A, GSK 4529
GSK1904529A, GSK 4529 GSK1904529A is a selective inhibitor of IGF1R with IC50 of 27 nM. 851.96 Formula C44H47F2N9O5S CAS Number 1089283-49-7...
View ArticleClik here to view.
GSK2334470
GSK2334470 GSK2334470; 1227911-45-6; GSK-2334470; GSK 2334470; (3S,6R)-1-[6-(3-Amino-1H-indazol-6-yl)-2-(methylamino)-4-pyrimidinyl]-N-cyclohexyl-6-methyl-3-piperidinecarboxamide...
View ArticleClik here to view.
BMS-248360, A NEW SARTAN ON HORIZON
2-[4-[(2-butyl-4-oxo-1,3-diazaspiro[4.4]non-1-en-3-yl)methyl]-2-[(3,3-dimethyl-2-oxopyrrolidin-1-yl)methyl]phenyl]-N-(3,4-dimethyl-1,2-oxazol-5-yl)benzenesulfonamide...
View ArticleClik here to view.
New...
CAS 1452582-16-9, 428.47, C23 H26 F2 N4 O2 1H-Indazole-3-carboxamide, 5-(2,3-difluorophenyl)-N-[[1-(2-methoxyethyl)-4-piperidinyl]methyl]- Aziende Chimiche Riunite Angelini Francesco...
View ArticleClik here to view.
4′-((5-(2,3-Dihydrobenzo[b][1,4]dioxin-6-yl)-1,3,4-oxadiazol-2-yl-thio)-methy...
Cas 1820758-44-8 C24 H18 F N3 O4 S 4′-((5-(2,3-Dihydrobenzo[b][1,4]dioxin-6-yl)-1,3,4-oxadiazol-2-yl-thio)-methyl)-4-fluorobiphenyl-2-carboxamide Glycogen synthase kinase-3 (GSK-3) is a...
View ArticleClik here to view.
New Antibacterial oxazolidinones in pipeline by Wockhardt
WCK ? (5S)-N-{3-[3,5-difluoro-4-(4-hydroxy-4-methoxymethyl-piperidin-1-yl)-phenyl]-2-oxo-oxazolidin-5-ylmethyl}-acetamide (5S)-N- {3-[3,5-difluoro-4-(4-hydroxy-(4-methoxymethyl)-piperidin-...
View ArticleClik here to view.
Pfizer’s PF 04937319 glucokinase activators for the treatment of Type 2 diabetes
PF 04937319 N,N-dimethyl-5-(2-methyl-6-((5-methylpyrazin-2-yl)-carbamoyl)benzofuran-4-yloxy)pyrimidine-2-carboxamide MW 432.43 MF C22 H20 N6 O4 CAS 1245603-92-2 2-Pyrimidinecarboxamide,...
View ArticleClik here to view.
Lefucoxib (乐福昔布)
Lefucoxib (乐福昔布) 5-(3,4-dimethyl-phenyl)-1-methanesulfonyl-3-trifluoromethol-pyrazole 1 [4- (methylsulfonyl) phenyl] -3-trifluoromethyl-5- (3,4-dimethylphenyl) – pyrazole CAS 849048-84-6 Molecular...
View ArticleClik here to view.
PNQ 370 useful in treating Parkinson’s disease from ADVINUS
PNQ 370 Advinus Therapeutics Ltd Adenosine A2a receptor antagonist for treating disease or disorder susceptible to improvement by antagonism of A2A receptor. Advinus Therapeutics is investigating...
View ArticleClik here to view.
PNQ 201 from Advinus for for potential treatment of IBD.
PNQ 201 STRUCTURE COMING…… Adenosine A2b receptor antagonist Advinus Therapeutics Ltd KEEP WATCHING THIS POST…………… PNQ-201 is a proprietary orally active A2B Adenosine receptor (A2BAdoR) antagonist,...
View Article